PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g043490.1
Common NameMTR_6g043490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 231aa    MW: 26025.3 Da    PI: 8.4916
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g043490.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.2e-09108149344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +W++ E++l+v +  ++G+g+W+ I++ +  ++t+ q++s+ 
  Medtr6g043490.1 108 PWSQLEHDLFVMGMIKYGKGRWSEIPKNFVCNKTPQQVQSYA 149
                      8*****************************89*******996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.464104157IPR017884SANT domain
SMARTSM007171.6E-6105155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-8108148IPR009057Homeodomain-like
PfamPF002492.2E-7108149IPR001005SANT/Myb domain
SuperFamilySSF466892.73E-9108155IPR009057Homeodomain-like
CDDcd001672.16E-7108153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MPIETTDLTN FLDSPPSPHI SSSNAPTILN FDHVFTNHNL HHHVQHHRHQ TTLLAPPTAQ  60
GNTHVSTRIT TDWPQPATHG RSLIARVLRP LPGSDTMPFP NASRLMVPWS QLEHDLFVMG  120
MIKYGKGRWS EIPKNFVCNK TPQQVQSYAT SFFRYLPDTY VHGLRKRKRN NMIVNNDLAK  180
ETLTLFPEVP TFYGGEASSS KNTNNYEAST YMTLHVGDGE VDVELRLGLN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1568301e-44AC156830.26 Medicago truncatula chromosome 8 clone mth2-151m10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013452040.11e-173MYB-like DNA-binding domain protein
TrEMBLA0A072UAF31e-173A0A072UAF3_MEDTR; MYB-like DNA-binding domain protein
STRINGGLYMA04G39975.11e-40(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14942612
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-13Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]